SAB1401798

Monoclonal Anti-LHX5 antibody produced in mouse

clone 1D9, ascites fluid

• Synonym(s): MGC129689
• MDL number: MFCD03096991
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1D9, monoclonal
• species reactivity: human
• technique(s): capture ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgG2aκ
• NCBI accession no.: NM_022363
• UniProt accession no.: Q9H2C1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LHX5(64211)

Description

General description

This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in the control of differentiation and development of the forebrain. In mice, this protein is essential for the regulation of precursor cell proliferation and the control of neuronal differentiation and migration during hippocampal development. This protein is involved in learning and motor functions in adult mice. (provided by RefSeq)

Immunogen

LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE

Physical form

Clear solution

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable