SAB1401320

Anti-PTH antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(s): PTH1
• MDL number: MFCD01324156
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_000315
• UniProt accession no.: P01270
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... PTH(5741)

Description

General description

The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). (provided by RefSeq)

Immunogen

PTH (NP_000306.1, 1 a.a. ~ 115 a.a) full-length human protein.

Sequence
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Biochem/physiol Actions

PTH (parathyroid hormone) is an important regulatory hormone for calcium homeostasis. In chronic kidney disease, hyperparathyroidism caused due to increased levels of PTH leads to arteriosclerotic fibrosis and calcification. Elevation in the levels of PTH might be associated with hypertension, bone disease and also in few cases it results in death due to cardiovascular disease. PTH is known to induce the secretion of aldosterone hormone in adrenocortex.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable