SAB1401142
Anti-FOLR3 antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonym(s):
FR-G, FR-gamma, gamma-hFR
Sign Into View Organizational & Contract Pricing
Select a Size
100 μG
$541.00
$541.00
Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
Notify Me
Get notified when this item is ready to ship via email.
All Photos(1)
Select a Size
Change View
100 μG
$541.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$541.00
Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
Notify Me
Get notified when this item is ready to ship via email.
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
western blot: 1 μg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FOLR3(2352)
General description
Folate receptor 3 (FOLR3) gene encodes a member of the folate receptor (FOLR) family, members of which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene includes two polymorphic variants; the shorter one has two base deletion in the CDS, resulting in a truncated polypeptide, compared to the longer one. Both protein products are constitutively secreted in hematopoietic tissues and are potential serum marker for certain hematopoietic malignancies. The longer protein has a 71% and 79% sequence homology with the FOLR1 and FOLR2 proteins, respectively(provided by RefSeq).
Folate receptor 3 (FOLR3) is a secreted protein, which is expressed mainly in hematopoietic tissues. FOLR3 gene is located on human chromosome 11q13.4. FOLR3 gene is 4.2 kb in size.
Folate receptor 3 (FOLR3) is a secreted protein, which is expressed mainly in hematopoietic tissues. FOLR3 gene is located on human chromosome 11q13.4. FOLR3 gene is 4.2 kb in size.
Immunogen
FOLR3 (AAI48786.1, 1 a.a. ~ 245 a.a) full-length human protein.
Sequence
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Sequence
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Biochem/physiol Actions
Folate receptor 3 (FOLR3) is a potential marker for hematopoietic malignancies. FOLR3 may regulate stem cell senescence. FOLR3 binds to folate with high affinity to mediate cellular uptake of folate.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Structure and regulation of a polymorphic gene encoding folate receptor type γ/γ?
Wang H, et al.
Nucleic Acids Research, 26(9) (1998)
Association of folate receptor (FOLR1, FOLR2, FOLR3) and reduced folate carrier (SLC19A1) genes with meningomyelocele
O'Byrne M, et al.
Birth Defects Research. Part B, Developmental and Reproductive Toxicology, 88(8) (2010)
Time-course transcriptional profiling of human amniotic fluid-derived stem cells using microarray
Kim Y, et al.
Cancer Research and Treatment : Official Journal of Korean Cancer Association, 42(2), 82-82 (2010)
Effects of chromosomal variations on pharmacokinetic activity of zolpidem in healthy volunteers: An array-based comparative genomic hybridization study
Moon H, et al.
Biochemical and Biophysical Research Communications, 356(4) (2007)
Novel functions of folate receptor alpha in CNS development and diseases
Mayanil C, et al.
Neuroscience Discovery, 2(1), 5-5 (2014)
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
