SAB1401068

Monoclonal Anti-CDSN antibody produced in mouse

clone 5B4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): D6S586E, HTSS, S
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 5B4, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): capture ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_001264
• UniProt accession no.: Q15517
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CDSN(1041)

Description

General description

This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. (provided by RefSeq)

Immunogen

CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable