Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

M1882

Sigma-Aldrich

Myoglobin from equine heart

Myoglobin from equine heart
1 of 1 reviewers received a sample product or took part in a promotion

≥90% (SDS-PAGE), essentially salt-free, lyophilized powder

Synonym(s):

Myoglobin from horse heart

Sign Into View Organizational & Contract Pricing

Select a Size

250 MG
$106.00
1 G
$377.00
5 G
$1,374.10
10 G
$2,375.10

$106.00


Available to ship onApril 29, 2025Details


Request a Bulk Order

Select a Size

Change View
250 MG
$106.00
1 G
$377.00
5 G
$1,374.10
10 G
$2,375.10

About This Item

CAS Number:
EC Number:
MDL number:
UNSPSC Code:
12352202
NACRES:
NA.61

$106.00


Available to ship onApril 29, 2025Details


Request a Bulk Order

biological source

equine heart

Quality Level

assay

≥90% (SDS-PAGE)

form

essentially salt-free, lyophilized powder

Iron content

≥0.20%

technique(s)

MALDI-MS: suitable

UniProt accession no.

storage temp.

−20°C

Gene Information

horse ... MB(100054434)

Looking for similar products? Visit Product Comparison Guide

Related Categories

application

Myoglobin from equine heart is suitable for use in:
  • spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
  • the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
  • the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
  • a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
  • a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]

Biochem/physiol Actions

Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.[6]

Storage Class

11 - Combustible Solids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, type N95 (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

D H Robertson et al.
Rapid communications in mass spectrometry : RCM, 11(7), 786-790 (1997-01-01)
Major urinary proteins (MUPs) from the urine of individual wild mice were characterized using electrospray ionization mass spectrometry (ESI-MS) and compared to MUPs from the urine of inbred mice. The wild mice showed considerable variation between individuals in the expression
Laurent Marichal et al.
Langmuir : the ACS journal of surfaces and colloids, 36(28), 8218-8230 (2020-06-26)
Protein adsorption on nanoparticles is an important field of study, particularly with regard to nanomedicine and nanotoxicology. Many factors can influence the composition and structure of the layer(s) of adsorbed proteins, the so-called protein corona. However, the role of protein
Ursula Waack et al.
mBio, 9(6) (2018-12-20)
Antibiotic-resistant Acinetobacter baumannii is increasingly recognized as a cause of difficult-to-treat nosocomial infections, including pneumonia, wound infections, and bacteremia. Previous studies have demonstrated that the metalloprotease CpaA contributes to virulence and prolongs clotting time when added to human plasma as
V Kery et al.
The Journal of biological chemistry, 269(41), 25283-25288 (1994-10-14)
The first committed step of transsulfuration is catalyzed by cystathionine beta-synthase (CBS), a known pyridoxal 5'-phosphate (PLP) enzyme. The inferred amino acid sequences of rat liver CBS and rat liver hemoprotein H-450 are identical. We now confirm the presence of
Computer-controlled perifusion system for neuroendocrine tissues: development and applications.
A Negro-Vilar et al.
Methods in enzymology, 124, 67-79 (1986-01-01)

Articles

Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.

Chromatograms

application for HPLC

Questions

1–7 of 7 Questions  
  1. Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?

    1 answer
    1. This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.

      Helpful?

  2. Do you have the sequence for Product M1882, Myoglobin from equine heart?

    1 answer
    1. Product M1882 - Myoglobin from equine heart is purified from equine heart.  It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service

      Helpful?

  3. What is the Department of Transportation shipping information for this product?

    1 answer
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

  4. Is Product M1882, Myoglobin from equine heart, oxidized?

    1 answer
    1. Yes, it is oxidized.

      Helpful?

  5. Is Product M1882, Myoglobin from equine heart, metmyoglobin?

    1 answer
    1. The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.

      Helpful?

  6. Which has more affinity for oxygen, hemoglobin or myoglobin?

    1 answer
    1. The affinity of myoglobin for oxygen is higher than that of hemoglobin.

      Helpful?

  7. What is the molecular weight of Product M1882, Myoglobin from equine heart?

    1 answer
    1. Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.

      Helpful?

Reviews

1 of 1 reviewers received a sample product or took part in a promotion

Active Filters

  1. New York
    • Review 1
    • Votes 0
    4 out of 5 stars.

    Is the myoglobin from equine heart dispersive in water?
    Or what are the solvent where it is dispersive.

    Helpful?

    1. Response from MilliporeSigma:

      Thank you for your review. We encourage customers who experience problems with our products to call or email us for additional technical support. Please visit https://www.sigmaaldrich.com/US/en/support/customer-support to submit a Product Technical Inquiry.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service