Skip to Content
MilliporeSigma
All Photos(7)

Documents

HPA037504

Sigma-Aldrich

Anti-UIMC1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-RAP80, Anti-Ubiquitin interaction motif containing 1

Sign Into View Organizational & Contract Pricing
All Photos(7)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA037504
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG

UniProt accession no.

Q96RL1

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UIMC1(51720)

General description

Ubiquitin interaction motif containing 1 (UIMC1), also called receptor-associated protein 8 (RAP80), is a transcriptional activator protein. It encodes a 79.6 kDa protein and is localised in nucleus. It is highly expressed in testis. UIMC1 contains a nuclear localization signal and two zinc fingers at the C-terminus. It has tandem ubiquitin interacting motifs (UIMs). The UIMC1 gene is located on human chromosome 5q35.2.

Immunogen

ubiquitin interaction motif containing 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Ubiquitin interaction motif containing 1 (UIMC1) functions as repressor for the nuclear receptor, retinoid-related, testis-associated receptor (RTR). It coordinates the placement of breast cancer type 1 susceptibility protein (BRCA1) in the site of DNA damage. Mutations in UIMC1 leads to impairment of BRCA1 mediated DNA repair and is implicated in breast cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79996

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Familial breast cancer screening reveals an alteration in the RAP80 UIM domain that impairs DNA damage response function
Nikkila J, et al.
Oncogene, 28(16), 90-95 (2017)
The ubiquitin-interacting motif-containing protein RAP80 interacts with BRCA1 and functions in DNA damage repair response
Yan J, et al.
Cancer Research, 67(14), 6647-6656 (2007)
RAP80, a novel nuclear protein that interacts with the retinoid-related testis-associated receptor
Yan Z, et al.
The Journal of Biological Chemistry, 277(35), 32379-32388 (2002)
Molecular Defects In BRCC3 Complex, a Novel Pathogenic Pathway In MDS
Makishima H, et al.
Blood, 122(21), 264-264 (2013)
Linkage-specific avidity defines the lysine 63-linked polyubiquitin-binding preference of rap80
Sims JJ and Cohen RE
Molecular Cell, 33(6), 775-783 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service