Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

HPA029814

Sigma-Aldrich

Anti-OSM antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FLAP-1, Anti-FLIIAP1, Anti-GCF-2, Anti-HUFI-1, Anti-TRIP, Anti-oncostatin M

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 1:100- 1:250
immunohistochemistry: 1:50- 1:200

immunogen sequence

SCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... OSM(5008)

General description

Oncostatin M (OSM) is produced by activated T cells, monocytes and Kaposi′s sarcoma cells. OSM shares several structural and functional characteristics with leukemia inhibitory factor (LIF), interleukin-6 (IL-6), and ciliary neurotrophic factor (CNTF).

Immunogen

oncostatin M recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. It can exert both stimulatory and inhibitory effects on cell proliferation. OSM stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi′s sarcoma cells, but, inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release [e.g. interleukin-6 (IL-6), granulocyte-macrophage colony-stimulating factor (GM-CSF) and granulocyte-colony-stimulating factor (G-CSF)] from endothelial cells, and enhances the expression of low-density lipoprotein receptor in hepatoma cells.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73545.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Abstracts and Case Studies From the College of American Pathologists 2016 Annual Meeting (CAP16).
Archives of pathology & laboratory medicine, 140(9), e2-e244 (2016-08-31)
Oncostatin M and leukemia inhibitory factor do not use the same functional receptor in mice.
Ichihara M
Blood, 90(1), 165-173 (1997)
Oncostatin M stimulates the growth of dermal fibroblasts via a mitogen-activated protein kinase-dependent pathway.
Ihn H and Tamaki K
Journal of Immunology, 165(4), 2149-2155 (2000)
Pulmonary expression of oncostatin M (OSM) promotes inducible BALT formation independently of IL-6, despite a role for IL-6 in OSM-driven pulmonary inflammation.
Botelho FM
Journal of Immunology, 191(3), 1453-1464 (2013)
L Guo et al.
Oncogene, 32(45), 5272-5282 (2013-01-16)
Inflammation can act as a crucial mediator of epithelial-to-mesenchymal transition (EMT). In this study, we show that oncostatin M (OSM) is expressed in an autocrine/paracrine fashion in invasive breast carcinoma. OSM stimulation promotes spontaneous lung metastasis of MCF-7 xenografts in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service