Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

HPA026864

Sigma-Aldrich

Anti-VDAC3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Outer mitochondrial membrane protein porin 3, Anti-VDAC-3, Anti-Voltage-dependent anion-selective channel protein 3, Anti-hVDAC3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 1-4 μg/mL
immunohistochemistry: 1:20- 1:50

immunogen sequence

TSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... VDAC3(7419)

General description

Voltage dependent anion channel 3 (VDAC3) is encoded by the gene mapped to human chromosome 8p11.2. The protein is predominantly expressed in testis. The protein consists of disulfide bridges with cysteine residues present on the barrel and exposed to the mitochondrial inter-membrane space.[1]

Immunogen

Voltage-dependent anion-selective channel protein 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-VDAC3 antibody produced in rabbit has been used in western blotting.[1] All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The human voltage dependent anion channel 3 (VDAC3) might be involved in the metabolism of cholesterol for steroidogenesis. VDAC3 functions as a pore-forming protein and regulates metabolite flux between mitochondria and cytoplasm. Channel gating of VDAC3 can be regulated via redox sensing under physiological conditions. In male mice, loss of VDAC3 leads to infertility.[2] VDAC3 present at the maternal centriole controls centriole assembly by linking Mps1 to the centrosome.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86796.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Isolation of a novel human voltage-dependent anion channel gene.
Rahmani Z
European Journal of Human Genetics, 6(4), 337-340 (1998)
Immotile sperm and infertility in mice lacking mitochondrial voltage-dependent anion channel type 3.
The Journal of Biological Chemistry, 276(42), 39206-39212 (2001)
A computational study of ion current modulation in hVDAC3 induced by disulfide bonds.
Guardiani C
Biochimica et Biophysica Acta, 1858(4), 813-823 (2016)
Mia Ydfors et al.
The Journal of physiology, 594(11), 3127-3140 (2015-12-04)
Mitochondrial respiratory sensitivity to ADP is thought to influence muscle fitness and is partly regulated by cytosolic-mitochondrial diffusion of ADP or phosphate shuttling via creatine/phosphocreatine (Cr/PCr) through mitochondrial creatine kinase (mtCK). Previous measurements of respiration in vitro with Cr (saturate
Masateru Okazaki et al.
Biochimica et biophysica acta, 1848(12), 3188-3196 (2015-09-27)
The voltage-dependent anion channels (VDACs), VDAC1, VDAC2, and VDAC3, are pore-forming proteins that control metabolite flux between mitochondria and cytoplasm. VDAC1 and VDAC2 have voltage-dependent gating activity, whereas VDAC3 is thought to have weak activity. The aim of this study

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service