Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

HPA023880

Sigma-Aldrich

Anti-PAGE4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-G antigen family C member 1, Anti-GAGE-9, Anti-PAGE-1, Anti-PAGE-4, Anti-Prostate-associated gene 4 protein

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$555.00

$555.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
$555.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

$555.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:500- 1:1000

immunogen sequence

DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PAGE4(9506)

General description

Prostate-associated Gene 4 (PAGE4) is mapped to human chromosome Xp11.21. The gene codes for a prostate specific tumor antigen PAGE4. The protein belongs to the PAGE family, which is a subgroup of cancer/testis antigens (CTAs). PAGE4 is highly expressed in uterine and prostate cancer. It is also expressed in normal prostate, male and female reproductive tissues at a basal level.

Immunogen

G antigen family C member 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry[1] against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Prostate-associated Gene 4 (PAGE4) is an intrinsically disordered protein (IDP) with an anti-apoptotic function in prostate cancer (PCa) cells. The encoded protein acts as a stress-response protein by controlling the production of reactive oxygen species and preventing DNA damage. PAGE 4, on phosphorylation by HIPK1 (Homeodomain Interacting Protein Kinase 1), enhances c-jun trans-activation and thus plays a major role in stress response pathway in diseased cells.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74320

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

PAGE4 is a cytoplasmic protein that is expressed in normal prostate and in prostate cancers.
Iavarone C
Molecular Cancer Therapeutics, 1(5), 329-335 (2002)
The cancer/testis antigen prostate-associated gene 4 (PAGE4) is a highly intrinsically disordered protein.
Zengg y
The Journal of Biological Chemistry, 286(16), 13985-13994 (2011)
Steven M Mooney et al.
Biochemistry, 53(10), 1670-1679 (2014-02-25)
Prostate-associated gene 4 (PAGE4) is a cancer/testis antigen that is typically restricted to the testicular germ cells but is aberrantly expressed in cancer. Furthermore, PAGE4 is developmentally regulated with dynamic expression patterns in the developing prostate and is also a
Bryan Marsh et al.
eLife, 11 (2022-07-08)
The human placenta contains two specialized regions: the villous chorion where gases and nutrients are exchanged between maternal and fetal blood, and the smooth chorion (SC) which surrounds more than 70% of the developing fetus but whose cellular composition and
Wen Liu et al.
Medicine, 102(32), e34611-e34611 (2023-08-11)
Cancer-associated fibroblasts (CAFs), the central players in the tumor microenvironment (TME), can promote tumor progression and metastasis via various functions. However, the properties of CAFs in prostate cancer (PCa) have not been fully assessed. Therefore, we aimed to examine the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service