Skip to Content
MilliporeSigma
All Photos(9)

Key Documents

HPA019472

Sigma-Aldrich

Anti-SST Antibody

enhanced validation

rabbit polyclonal

Synonym(s):

Anti-Growth hormone release-inhibiting factor, Anti-Somatostatin

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$555.00

$555.00


Check Cart for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1042


Select a Size

Change View
100 μL
$555.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

$555.00


Check Cart for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1042

Product Name

Anti-SST antibody produced in rabbit, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL

immunogen sequence

APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SST(6750)

General description

SST (somatostatin) is present in two active forms SST-14 (14 amino acids length) and SST-28.

Immunogen

Somatostatin Precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-SST antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SST (somatostatin) functions by binding to the G protein-coupled receptor (somatostatin receptors). It is a peptide hormone which is produced in the hypothalamus, the gastrointestinal tract and the endocrine pancreas. SST inhibits hormone secretion and gastrointestinal function. In presence of glucose and amino acids, SST-14 is released from δ-cells in pancreatic islets of Langerhans. It suppresses the secretion of insulin and glucagon. In the gastrointestinal tract, SST suppresses gallbladder contraction and reduces secretion.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74709

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jennifer E Bruin et al.
Diabetes, 65(5), 1297-1309 (2016-01-08)
Pancreatic progenitors derived from human embryonic stem cells (hESCs) are a potential source of transplantable cells for treating diabetes and are currently being tested in clinical trials. Yet, how the milieu of pancreatic progenitor cells, including exposure to different factors
Xiang-Dong Wan et al.
CNS neuroscience & therapeutics, 30(7), e14863-e14863 (2024-07-22)
Childhood sensory abnormalities experience has a crucial influence on the structure and function of the adult brain. The underlying mechanism of neurological function induced by childhood sensory abnormalities experience is still unclear. Our study was to investigate whether the GABAergic
Jonathan Strosberg et al.
World journal of gastroenterology, 16(24), 2963-2970 (2010-06-24)
Somatostatin analogs were initially developed for the control of hormonal syndromes associated with neuroendocrine tumors (NETs). In recent years, accumulating data has supported their role as antiproliferative agents, capable of stabilizing tumor growth in patients with metastatic neuroendocrine malignancies, including
Michael B Krawchuk et al.
Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism, 40(7), 1427-1440 (2019-08-17)
The impact of different neuronal populations on local cerebral blood flow (CBF) regulation is not well known and insight into these relationships could enhance the interpretation of brain function and dysfunction from brain imaging data. We investigated the role of
Balrik Kailey et al.
American journal of physiology. Endocrinology and metabolism, 303(9), E1107-E1116 (2012-08-31)
Somatostatin-14 (SST) inhibits insulin and glucagon secretion by activating G protein-coupled somatostatin receptors (SSTRs), of which five isoforms exist (SSTR1-5). In mice, the effects on pancreatic β-cells are mediated by SSTR5, whereas α-cells express SSTR2. In both cell types, SSTR

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service