Skip to Content
MilliporeSigma
All Photos(5)

Key Documents

HPA018215

Sigma-Aldrich

Anti-GUCA2A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Gap-I, Anti-Guanylate cyclase activator 2A, Anti-Guanylate cyclase-activating protein 1, Anti-Guanylin precursor

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$598.00

$598.00


Check Cart for Availability


Select a Size

Change View
100 μL
$598.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

$598.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:1000-1:2500
western blot: 0.04-0.4 μg/mL

immunogen sequence

SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GUCA2A(2980)

General description

The gene guanylate cyclase activator 2A (GUCA2A) is mapped to human chromosome 1p35-p34. GUCA2A mRNA is mainly detected in the gastrointestinal tract and kidney.

Immunogen

Guanylin precursor recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

Guanylate cyclase activator 2A (GUCA2A) is mainly an intestinal peptide hormone and endogenous ligand of guanylyl cyclase C. It is produced as prohormone proguanylin. In the intestine, GUCA2A along with guanylate cyclase C receptor activates epithelial cells. Activation of this pathway results in secretion of Cl- and HCO3- and inhibition of Na+ absorption, which drives water secretion into the intestinal lumen. In the renal tissue GUCA2A elicits natriuresis, kaliuresis, and diuresis, along with increasing urinary cyclic guanosine monophosphate (cGMP) levels. GUCA2A is suggested to elevate the exrection of urinary salt and water, which results in the prevention of hypernatremia and hypervolemia following increased salt uptake by the body. The protein is also expressed in epithelial cells of the ductal system of human parotid and submandibular glands. It is released into the saliva through salivary duct cells. GUCA2A is highly expressed in salivary gland tumors. On the other hand, GUCA2A is down-regulated in colorectal cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72418

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Amanda M Pattison et al.
Cancer biology & therapy, 21(9), 799-805 (2020-07-01)
Most sporadic colorectal cancer reflects acquired mutations in the adenomatous polyposis coli (APC) tumor suppressor gene, while germline heterozygosity for mutant APC produces the autosomal dominant disorder Familial Adenomatous Polyposis (FAP) with a predisposition to colorectal cancer. In these syndromes
Thomas Mueller et al.
Kidney international, 82(12), 1253-1255 (2012-12-04)
According to a proposed concept of a gastrointestinal-renal natriuretic signaling axis, natriuretic peptides are released from the intestine into the circulation in response to oral salt intake and act on the kidneys as hormones to increase sodium excretion. The peptides
Hasan Kulaksiz et al.
The American journal of pathology, 161(2), 655-664 (2002-08-07)
Cystic fibrosis transmembrane conductance regulator (CFTR)-mediated secretion of an electrolyte-rich fluid is a major but incompletely understood function of the salivary glands. We provide molecular evidence that guanylin, a bioactive intestinal peptide involved in the CFTR-regulated secretion of electrolyte/water in
Erik S Blomain et al.
Cancer biology & therapy, 21(5), 441-451 (2020-02-11)
Sporadic colorectal cancer initiates with mutations in APC or its degradation target β-catenin, producing TCF-dependent nuclear transcription driving tumorigenesis. The intestinal epithelial receptor, GUCY2C, with its canonical paracrine hormone guanylin, regulates homeostatic signaling along the crypt-surface axis opposing tumorigenesis. Here
Thomas Lauber et al.
Biochemistry, 41(49), 14602-14612 (2002-12-05)
Guanylin, an intestinal peptide hormone and endogenous ligand of guanylyl cyclase C, is produced as the corresponding prohormone proguanylin. The mature hormone consists of 15 amino acid residues, representing the COOH-terminal part of the prohormone comprised of 94 amino acid

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service