HPA015325
Anti-CDK17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-PCTAIRE- motif protein kinase 2, Anti-PCTK2 antibody produced in rabbit, Anti-Serine/threonine-protein kinase PCTAIRE-2
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
immunogen sequence
RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PCTK2(5128)
General description
CDK17 (cyclin-dependent kinase 17) belongs to a subfamily of Cdc2-related kinases, and is exclusively expressed in brain. It is expressed usually in post-mitotic cells. In brains, it has predominant expression in olfactory bulb and hippocampus, which are generally made of post-mitotic neurons. This gene is localized to human chromosome 12q23.1, which codes for a protein composed of 523 amino acids, and has a molecular weight of 60kDa. It contains a central kinase domain and one N- and C-terminal domain each.
Immunogen
Serine/threonine-protein kinase PCTAIRE-2 recombinant protein epitope signature tag (PrEST)
Application
Anti-CDK17 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
CDK17 (cyclin-dependent kinase 17) acts as a serine/threonine kinase, and phosphorylates histone H1. It is an interacting partner of Trap (tudor repeat associator with PCTAIRE 2), and it interacts with it through its N-terminal.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST73465
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Adam R Cole
Neuro-Signals, 17(4), 288-297 (2009-10-10)
PCTAIRE kinases (PCTKs) are highly conserved serine/threonine kinases that are closely related to cyclin-dependent kinases. They are enriched in post-mitotic neurons of adult brains, suggesting they might perform important neuron-specific functions independent of the cell cycle. So far, the biological
T Hirose et al.
European journal of biochemistry, 267(7), 2113-2121 (2000-03-23)
PCTAIRE 2 is a Cdc2-related kinase that is predominantly expressed in the terminally differentiated neuron. To elucidate the function of PCTAIRE 2, proteins that associate with PCTAIRE 2 were screened by the yeast two-hybrid system. A positive clone was found
T Hirose et al.
European journal of biochemistry, 249(2), 481-488 (1997-11-25)
PCTAIRE are members of a subfamily of Cdc2-related kinases that have been shown to be preferentially expressed in post-mitotic cells. To examine the neural functions of PCTAIRE, rat cDNA clones encoding PCTAIRE 1, 2, and 3 were isolated, and their
Time-resolved dissection of early phosphoproteome and ensuing proteome changes in response to TGF-β.
Rochelle C J D'Souza et al.
Science signaling, 7(335), rs5-rs5 (2014-07-25)
Transforming growth factor-β (TGF-β) signaling promotes cell motility by inducing epithelial-to-mesenchymal transitions (EMTs) in normal physiology and development, as well as in pathological conditions, such as cancer. We performed a time-resolved analysis of the proteomic and phosphoproteomic changes of cultured
Time-resolved dissection of early phosphoproteome and ensuing proteome changes in response to TGF-?.
D'Souza RC, Knittle AM, Nagaraj N, et al.
Science Signaling, 7(335), rs5-rs5 (2014)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service