HPA011129
Anti-NDST4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 antibody produced in rabbit, Anti-Glucosaminyl N-deacetylase/N-sulfotransferase 4 antibody produced in rabbit, Anti-N-HSST 4 antibody produced in rabbit, Anti-N-heparan sulfate sulfotransferase 4 antibody produced in rabbit, Anti-NDST-4 antibody produced in rabbit
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$598.00
$598.00
Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
All Photos(5)
Select a Size
Change View
100 μL
$598.00
About This Item
$598.00
Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:50- 1:200
immunogen sequence
GYKQEMTLIETTAEAECTDIKILPYRSMELKTVKPIDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQ
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NDST4(64579)
General description
NDST4 (N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) is the fourth member of NDST family, and shows high sequence homology to the other three members namely, NDST1, NDST2 and NDST3. It is made of 872 amino acids. This gene is localized to human chromosome 4q26, and alternative splicing gives rise to two isoforms of this protein. This protein is majorly expressed in developing embryos, and in adult brain. It is a type II transmembrane protein with 22 amino acids in the transmembrane region, and 12-13 amino acids in the cytoplasmic domain. It also shares two PAPS (3′-phosphoadenosine 5′-phosphosulfate) binding motifs, with other sulfotransferases.
Immunogen
Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
The functionality of NDST4 (N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) is not yet characterized. It has higher sulfotransferase activity and lower deacetylase activity. It catalyzes the synthesis of heparan sulfate (HS) on existing proteins to form heparan sulfate proteoglycans (HSPGs). This gene is down-regulated in colorectal cancer (CRC), and is associated with advanced cancer phenotype. It is associated with invasiveness and metastasis of CRC, which might be an outcome of alterations in the HS chains of certain HSPGs. Therefore, NDST4 might have potential as a marker to predict the prognosis of CRC. This protein might be responsible for the addition of sulfate groups to glucosaminyl residues, which were deacetylated and left unaltered by other NDST members. Genome-wide association studies show that SNP near this gene is associated with maximum number of drinks (MaxDrinks), which is related to alcohol dependence.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST71993
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Sheng-Tai Tzeng et al.
PloS one, 8(6), e67040-e67040 (2013-07-05)
Genomic deletion at tumor suppressor loci is a common genetic aberration in human cancers. The study aimed to explore candidate tumor suppressor genes at chromosome 4q25-q28.2 and to delineate novel prognostic biomarkers associated with colorectal cancer (CRC). Deletion mapping of
Yue Pan et al.
Journal of psychiatric research, 47(11), 1717-1724 (2013-08-21)
Maximum number of drinks (MaxDrinks) defined as "Maximum number of alcoholic drinks consumed in a 24-h period" is an intermediate phenotype that is closely related to alcohol dependence (AD). Family, twin and adoption studies have shown that the heritability of
J Aikawa et al.
The Journal of biological chemistry, 276(8), 5876-5882 (2000-11-23)
We report the cloning and partial characterization of the fourth member of the vertebrate heparan sulfate/heparin: GlcNAc N-deacetylase/GlcN N-sulfotransferase family, which we designate NDST4. Full-length cDNA clones containing the entire coding region of 872 amino acids were obtained from human
Kay Grobe et al.
The Journal of biological chemistry, 277(34), 30699-30706 (2002-06-19)
We report the full-length 5'-untranslated region (5'-UTR) sequences of the four vertebrate heparan sulfate/heparin GlcNAc N-deacetylase/N-sulfotransferases (NDSTs) and their role in translational regulation in vivo and in vitro. All four NDST 5'-UTR sequences are unusually long, have a high degree
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
