HPA005719

Anti-USP33 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-KIAA1097, Anti-VDU1, Anti-ubiquitin specific peptidase 33
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA005719
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• immunogen sequence: ESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALS
• UniProt accession no.: Q8TEY7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... USP33(23032)

Description

General description

Ubiquitin specific peptidase 33 (USP33) belongs to the ubiquitin-specific protease (USP) subclass. It is localized to the cytoplasm, including the endoplasmic reticulum. A short isoform of USP33 is present in the Golgi apparatus.

Immunogen

ubiquitin specific peptidase 33 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Agonist-induced ubiquitination of the β2 adrenergic receptor (β2AR) is an important post-translational modification to sort internalized receptors to the lysosomes for degradation. This ubiquitination is reversed by ubiquitin specific peptidase 3 (USP33), hence inhibiting lysosomal trafficking, promoting receptor recycling from the late-endosomal compartments and re-sensitization of recycled receptors at the cell surface. Dissociation of the bound USP33 from the β2AR immediately after agonist stimulation and re-association on prolonged agonist treatment, allows receptors to first become ubiquitinated and then deubiquitinated. Thus, this acts as a ‘trip switch′ between degradative and recycling pathways at the late-endosomal compartments. USP33 also binds to β-arrestin2 and leads to the deubiquitination of β-arrestins. Along with Mdm2, it functions to favor the stability receptor β-arrestin complex, thus regulating its longevity and subcellular localization.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70778

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable