Skip to Content
MilliporeSigma
All Photos(6)

Documents

HPA005640

Sigma-Aldrich

Anti-NDUFB5 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CI-SGDH antibody produced in rabbit, Anti-Complex I-SGDH antibody produced in rabbit, Anti-NADH dehydrogenase (ubiquinone) 1β-subcomplex subunit 5, mitochondrial precursor antibody produced in rabbit, Anti-NADH-ubiquinone oxidoreductase SGDH subunit antibody produced in rabbit

Sign Into View Organizational & Contract Pricing
All Photos(6)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA005640
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN

UniProt accession no.

O43674

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NDUFB5(4711)

General description

NADH dehydrogenase [ubiquinone] 1 β-subcomplex subunit 5 (NDUFB5) is a subunit of complex 1 (NADH: ubiquinone oxidoreductase) which belongs to the electron transport chain. It belongs to the NDUFB5/SGDH protein family which is highly conserved in fungi, plants and mammals. NDUFB5 is located in the inner mitochondrial membrane.

Immunogen

NADH dehydrogenase (ubiquinone) 1β-subcomplex subunit 5, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

NADH dehydrogenase [ubiquinone] 1 β-subcomplex subunit 5 (NDUFB5), two mobile electron carriers and five multiprotein complexes (Complexes 1-5) are all involved in the production of ATP, generation of a proton gradient in the inner mitochondrial membrane and finally conversion of ADP to ATP. Overall, the function of complex 1 is to pass electrons from NADH to ubiquinone, simultaneously pumping hydrogen ions from the matrix of the mitochondria to inter-membrane space.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86647

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

p16Ink4a-induced senescence of pancreatic beta cells enhances insulin secretion
Aharon Helman
Nature Medicine, 22(4), 412-420 (2016)
Pierre Cardol
Biochimica et biophysica acta, 1807(11), 1390-1397 (2011-07-14)
Complex I (NADH:ubiquinone oxidoreductase) is the largest enzyme of the mitochondrial respiratory chain. Compared to its bacterial counterpart which encompasses 14-17 subunits, mitochondrial complex I has almost tripled its subunit composition during evolution of eukaryotes, by recruitment of so-called accessory
Aharon Helman et al.
Nature medicine, 22(4), 412-420 (2016-03-08)
Cellular senescence is thought to contribute to age-associated deterioration of tissue physiology. The senescence effector p16(Ink4a) is expressed in pancreatic beta cells during aging and limits their proliferative potential; however, its effects on beta cell function are poorly characterized. We
Gene Expression Profiles Discriminate between Pathological Complete Response and Resistance to Neoadjuvant FEC100 in Breast Cancer
Millour Marie
Cancer, Genomics, and Proteomics, 3(2), 89-95 (2006)
J L Loeffen et al.
Biochemical and biophysical research communications, 253(2), 415-422 (1999-01-08)
NADH:ubiquinone oxidoreductase (complex I) is an extremely complicated multiprotein complex located in the inner mitochondrial membrane. Its main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service