AV54283
Anti-APOE antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-AD2, Anti-Apolipoprotein E, Anti-Apoprotein, Anti-MGC1571
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
34 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
Storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... APOE(348)
General description
APOE gene encodes for Apolipoprotein E, a main apoprotein of the chylomicron. ApoE is a 299 amino acid containing plasma protein with a molecular weight of 34kDa. It is synthesized primarily in liver and is mapped on to chromosome 19 in a cluster with APOC1 and APOC2.
Immunogen
Synthetic peptide directed towards the N terminal region of human APOE
Application
Anti-APOE antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
ApoE binds to its specific receptor and mediates the transport of lipid and cholesterol, ligands for the low-density lipoprotein (LDL) and very low density lipoprotein (VLDL) receptors, through the bloodstream. It is also involved in repair mechanism against tissue injury. For example, increased amounts of apolipoprotein E are present at peripheral nerve injury and regeneration site. Mutation in APOE gene leads to familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides results in impaired clearance of chylomicron and VLDL remnant.
Sequence
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
W A Groenewegen et al.
Arteriosclerosis and thrombosis : a journal of vascular biology, 14(11), 1695-1704 (1994-11-01)
We identified the first insertion mutation that specifies an apolipoprotein (apo)B truncation, apoB-70.5, in a father and son with hypobetalipoproteinemia (total and low-density lipoprotein [LDL] cholesterol < 5th percentile, plasma apoB levels approximately one third of normal). The mutation is
Y K Paik et al.
Proceedings of the National Academy of Sciences of the United States of America, 82(10), 3445-3449 (1985-05-01)
The gene for human apolipoprotein E (apo-E) was selected from a library of cloned genomic DNA by screening with a specific cDNA hybridization probe, and its structure was characterized. The complete nucleotide sequence of the gene as well as 856
María Solanas-Barca et al.
Atherosclerosis, 222(2), 449-455 (2012-04-07)
Rare mutations in the APOE gene, undetectable with the usual genotyping technique, are responsible for dominant familial dysbetalipoproteinemia (FD) and therefore could be easily misclassified as familial combined hyperlipidemia (FCHL). We aimed to identify APOE mutations associated with dominant combined
R W Mahley
Science (New York, N.Y.), 240(4852), 622-630 (1988-04-29)
Apolipoprotein E is a plasma protein that serves as a ligand for low density lipoprotein receptors and, through its interaction with these receptors, participates in the transport of cholesterol and other lipids among various cells of the body. A mutant
Barbara Castella et al.
Nature communications, 8, 15663-15663 (2017-06-06)
Vγ9Vδ2 T cells are activated by phosphoantigens, such as isopentenyl pyrophosphate (IPP), which is generated in the mevalonate pathway of antigen-presenting cells. IPP is released in the extracellular microenvironment via unknown mechanisms. Here we show that the ATP-binding cassette transporter
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
