Synthetic peptide directed towards the N terminal region of human ATG16L1
Application
Anti-ATG16L1 (AB1) antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions
ATG16L1 (autophagy related 16-like 1) is an autophagy-related (ATG) protein. It plays an essential role as a component of the ATG12-ATG5-ATG16L1 complex during autophagy. It functions as a molecular scaffold to form the autophagosome in response to classical and pathogen-related autophagy stimuli. The complex introduces LC3 (ATG8 in yeast) to the autophagosome and connects it to the phosphatidylethanolamine (PE). This conjugation generates a membrane-bound activated form of LC3 named LC3-II.
Sequence
Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Autophagy is a fundamental cellular process required for organelle degradation and removal of invasive pathogens. Autophagosome formation involves the recruitment of, and interaction between, multiple proteins produced from autophagy-related (ATG) genes. One of the key complexes in autophagosome formation is
Selective autophagy underlies many of the important physiological roles that autophagy plays in multicellular organisms, but the mechanisms involved in cargo selection are poorly understood. Here we describe a molecular mechanism that can target conventional endosomes for autophagic degradation. We
Arteriosclerosis, thrombosis, and vascular biology, 35(5), 1226-1235 (2015-03-15)
Autophagy has emerged as a cell survival mechanism critical for cellular homeostasis, which may play a protective role in atherosclerosis. ATG16L1, a protein essential for early stages of autophagy, has been implicated in the pathogenesis of Crohn's disease. However, it
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
