Synthetic peptide directed towards the N terminal region of human LYZL6
Application
Anti-LYZL6 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
LYZL6 (lysozyme-like 6) gene encodes a 148 amino acid containing secreted protein that belongs to glycosyl hydrolase 22 family and is predominantly expressed in testis and epididymis. It may facilitate the maturation and/or storage of sperm and might play a role in contributing to the innate immunity of the male genital tract. LYZL6 also possesses bacteriolytic activity against Micrococcus lysodeikticus.
Sequence
Synthetic peptide located within the following region: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Asian journal of andrology, 15(6), 824-830 (2013-09-10)
C-type lysozyme genes (Lyzls) belong to the class of lysozymes and are highly expressed in the testis and epididymis. The members Lyzl4 and Spaca3 have been reported to play a role in sperm-egg binding and fertilisation in mice. However, the
Journal of bioscience and bioengineering, 118(4), 420-425 (2014-04-22)
Lysozyme acts as an important defensive factor in innate immunity due to its well-recognized bacteriolytic activity. Here we describe the production and performance of human lysozyme-like 6 (LYZL6), a novel human c-type lysozyme homolog. A synthetic codon-optimized cDNA encoding the
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.