AV53618
Anti-ADAM7 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-ADAM metallopeptidase domain 7, Anti-EAPI, Anti-GP-83
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$541.00
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
Notify Me
Get notified when this item is ready to ship via email.
All Photos(1)
Select a Size
Change View
100 μL
$541.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
Notify Me
Get notified when this item is ready to ship via email.
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
83 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ADAM7(8756)
General description
ADAM7 (ADAM metallopeptidase domain 7) gene encodes a single-pass type I membrane protein that belongs to ADAMs family of zinc proteases and is expressed in melanoma cells. It has a role in epididymosomes and is an integral plasma membrane protein in sperm that has unique secretory feature and interactive relationship during epididymis-to-sperm transfer process. Mutation in ADAM7 gene results in melanoma progression.
Immunogen
Synthetic peptide directed towards the C terminal region of human ADAM7
Application
Anti-ADAM7 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
Adam7 resides in an intracellular compartment of epididymal cells and is transferred to sperm membranes, where its levels are dependent on the expression of Adam2 and Adam3, which play critical roles in fertilization. It functions in fertilization through the formation of a chaperone complex and enhances association with integral membrane protein 2B (Itm2b) during capacitation in sperm. It also helps in the maturation of sperm cells in mammals and also plays a unique secretory feature and interactive relationship with sperm.
Sequence
Synthetic peptide located within the following region: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Jungsu Oh et al.
Biochemical and biophysical research communications, 331(4), 1374-1383 (2005-05-11)
The mammalian epididymis is critical for sperm to acquire motility and fertilizing capacity. This maturation process involves the interaction of epididymal secretory proteins with sperm. We analyzed mouse a disintegrin and metalloprotease (ADAMs) 7 and 28 expressed specifically or predominantly
Jeong Su Oh et al.
Molecules and cells, 28(5), 441-446 (2009-10-27)
During epididymal transit, mammalian sperm acquire selected proteins secreted by the epididymis. We previously showed that a disintegrin and metalloprotease (ADAM) 7 is expressed specifically in the epididymis and transferred to the sperm surface during epididymal transit. Here, we show
Cecil Han et al.
Journal of cellular physiology, 226(5), 1186-1195 (2010-10-15)
In mammals, sperm acquire their motility and ability to fertilize eggs in the epididymis. This maturation process involves the acquisition of particular proteins from the epididymis. One such secretory protein specifically expressed in the epididymis is Adam7 (a disintegrin and
Xiaomu Wei et al.
Human mutation, 32(6), E2148-E2175 (2011-05-28)
We performed a mutational analysis of the 19 disintegrin-metalloproteinases (ADAMs) genes in human cutaneous metastatic melanoma and identified eight to be somatically mutated in 79 samples, affecting 34% of the melanoma tumors analyzed. Functional analysis of the two frequently mutated
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
