Synthetic peptide directed towards the middle region of human PHF6
Application
Anti-PHF6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions
PHD finger protein 6 (PHF6) localizes to the nucleolus and has a role in transcriptional regulation. It regulates cell cycle progression by suppressing the synthesis of ribosomal RNA. Mutations in PHF6 gene have been implicated in Borjeson-Forssman-Lehmann syndrome and chronic myeloid leukemia.
Sequence
Synthetic peptide located within the following region: LEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRSP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of biological chemistry, 289(14), 10069-10083 (2014-02-21)
The plant homeodomain finger 6 (PHF6) was originally identified as the gene mutated in the X-linked mental retardation disorder Börjeson-Forssman-Lehmann syndrome. Mutations in the PHF6 gene have also been associated with T-cell acute lymphoblastic leukemia and acute myeloid leukemia. Approximately
Somatic mutations of PHF6 in patients with chronic myeloid leukemia in blast crisis.
The Journal of biological chemistry, 288(5), 3174-3183 (2012-12-12)
Mutation of PHF6, which results in the X-linked mental retardation disorder Börjeson-Forssman-Lehmann syndrome, is also present in about 38% of adult T-cell acute lymphoblastic leukemias and 3% of adult acute myeloid leukemias. However, it remains to be determined exactly how
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
