AV51213
Anti-UXT (AB2) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-ART-27, Anti-Ubiquitously-expressed transcript
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$457.00
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(1)
Select a Size
Change View
100 μL
$457.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
19 kDa
species reactivity
rat, dog, rabbit, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... UXT(8409)
Immunogen
Synthetic peptide directed towards the N terminal region of human UXT
Application
Anti-UXT (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
Ubiquitously-expressed, prefoldin-like chaperone (UXT; ART-27) is a cofactor that modulates the androgen receptor-dependent transcription. It reportedly has roles in prostate cancer progression and induction of apoptosis by mitochondrial aggregation or TNF-induced pathway.
Sequence
Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Samir S Taneja et al.
The Journal of biological chemistry, 279(14), 13944-13952 (2004-01-09)
Androgen receptor trapped clone-27 (ART-27) is a newly described transcriptional coactivator that binds to the N terminus of the androgen receptor (AR). Given the vital importance of AR signaling in prostate growth and differentiation, we investigated the role of ART-27
Tijuana N Moss et al.
In vitro cellular & developmental biology. Animal, 43(3-4), 139-146 (2007-06-08)
Mitochondria are the bioenergetic and metabolic centers in eukaryotic cells and play a central role in apoptosis. Mitochondrial distribution is controlled by the microtubular cytoskeleton. The perinuclear aggregation of mitochondria is one of the characteristics associated with some types of
Yuefeng Huang et al.
Molecular biology of the cell, 22(8), 1389-1397 (2011-02-11)
Proteins that directly regulate tumor necrosis factor (TNF) signaling have critical roles in determining cell death and survival. Previously we characterized ubiquitously expressed transcript (UXT)-V2 as a novel transcriptional cofactor to regulate nuclear factor-κB in the nucleus. Here we report
Min Ji Yoon et al.
Nature communications, 12(1), 1955-1955 (2021-03-31)
p62/SQSTM1 is known to act as a key mediator in the selective autophagy of protein aggregates, or aggrephagy, by steering ubiquitinated protein aggregates towards the autophagy pathway. Here, we use a yeast two-hybrid screen to identify the prefoldin-like chaperone UXT
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
