Synthetic peptide directed towards the C terminal region of human NAGS
Application
Anti-NAGS antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions
N-acetylglutamate synthase (NAGS) is a mitochondrial enzyme that catalyzes the reaction between glutamate and acetyl coenzyme-A to form N-acetylglutamate. NAG regulates ureagenesis since it is the cofactor of the enzyme (carbamyl phosphate synthetase I) that catalyzes the first step of the urea cycle. Deficiency of NAGS results in hyperammonemia.
Sequence
Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of inherited metabolic disease, 30(3), 400-400 (2007-05-19)
N-acetylglutamate synthase (NAGS) deficiency is a rare urea cycle disorder. An effective treatment, N-carbamoyl-L-glutamic acid (NCGA), is now available, increasing the importance of identifying and treating these patients early. We describe a case with genetically verified NAGS deficiency and neonatal
European journal of pediatrics, 169(2), 197-199 (2009-06-18)
N-Acetylglutamate synthase (NAGS) deficiency is a rare urea cycle disorder, which may present in the neonatal period with severe hyperammonemia and marked neurological impairment. We report on a Turkish family with a patient who died due to hyperammonemia in the
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.