Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV50131

Sigma-Aldrich

Anti-ORAI2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-C7orf19, Anti-CBCIP2, Anti-FLJ12474, Anti-FLJ14733, Anti-ORAI calcium release-activated calcium modulator 2, Anti-TMEM142B

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$541.00

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.


Select a Size

Change View
100 μL
$541.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

28 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ORAI2(80228)

General description

The gene ORAI calcium release-activated calcium modulator 2 (ORAI2) is mapped to human chromosome 7q22.1. ORAI2 is expressed in human platelets and retinal pigment epithelium.

Immunogen

Synthetic peptide directed towards the middle region of human ORAI2

Application

Anti-ORAI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/mL.

Biochem/physiol Actions

ORAI calcium release-activated calcium modulator 2 (ORAI2) is a membrane calcium channel that regulates the influx of calcium into the cells. It is a calcium release-activated calcium (CRAC) channel.

Sequence

Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Lutz P Breitling et al.
American journal of human genetics, 88(4), 450-457 (2011-04-05)
Tobacco smoking is responsible for substantial morbidity and mortality worldwide, in particular through cardiovascular, pulmonary, and malignant pathology. CpG methylation might plausibly play a role in a variety of smoking-related phenomena, as suggested by candidate gene promoter or global methylation
Wayne I DeHaven et al.
The Journal of biological chemistry, 282(24), 17548-17556 (2007-04-25)
The recent discoveries of Stim1 and Orai proteins have shed light on the molecular makeup of both the endoplasmic reticulum Ca(2+) sensor and the calcium release-activated calcium (CRAC) channel, respectively. In this study, we investigated the regulation of CRAC channel
Sönke Cordeiro et al.
Graefe's archive for clinical and experimental ophthalmology = Albrecht von Graefes Archiv fur klinische und experimentelle Ophthalmologie, 249(1), 47-54 (2010-07-08)
The retinal pigment epithelium (RPE) fulfills a large variety of tasks that are important for visual function. Many of these tasks, such as phagocytosis, growth factor secretion, or transepithelial ion transport, are regulated by increases in intracellular Ca²(+) as second-messenger.
Alejandro Berna-Erro et al.
Biochimica et biophysica acta, 1823(8), 1242-1251 (2012-05-30)
Discharge of the intracellular Ca(2+) stores activates Ca(2+) entry through store-operated channels (SOCs). Since the recent identification of STIM1 and STIM2, as well as the Orai1 homologs, Orai2 and Orai3, the protein complexes involved in Ca(2+) signaling needs re-evaluation in

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service