Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV49592

Sigma-Aldrich

Anti-CACHD1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Cache domain containing 1, Anti-KIAA1573, Anti-RP4-655E10.1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$541.00

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.


Select a Size

Change View
100 μL
$541.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

137 kDa

species reactivity

mouse, horse, human, dog, guinea pig, rabbit, bovine, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CACHD1(57685)

General description

The gene CAHD1 (Cache domain-containing protein 1) is mapped to human chromosome 1p31.3.

Immunogen

Synthetic peptide directed towards the N terminal region of human CACHD1

Application

Anti-CACHD1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

CACHD1 (Cache domain-containing protein 1) is a calcium channel protein that is important for excitation-contraction coupling. It is differentially regulated in humans suffering from parkinson disease. CACHD1 is up-regulated in human embryonic stem cells and is down-modulated upon differentiation.

Sequence

Synthetic peptide located within the following region: HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Bhaskar Bhattacharya et al.
BMC developmental biology, 5, 22-22 (2005-10-07)
The identification of molecular pathways of differentiation of embryonic stem cells (hESC) is critical for the development of stem cell based medical therapies. In order to identify biomarkers and potential regulators of the process of differentiation, a high quality microarray
Biomarkers in Parkinson Disease: global gene expression analysis in peripheral blood from patients with and without mutations inPARK2 and PARK8.
Aguiar PMC & Severino P
Einstein (S?o Paulo, Brazil), 8, 291-297 (2010)
Diane Meyre Rassi et al.
Annals of the New York Academy of Sciences, 1150, 282-289 (2009-01-06)
The MHC region (6p21) aggregates the major genes that contribute to susceptibility to type 1 diabetes (T1D). Three additional relevant susceptibility regions mapped on chromosomes 1p13 (PTPN22), 2q33 (CTLA-4), and 11p15 (insulin) have also been described by linkage studies. To
Graeme S Cottrell et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 38(43), 9186-9201 (2018-09-06)
The putative cache (Ca2+ channel and chemotaxis receptor) domain containing 1 (CACHD1) protein has predicted structural similarities to members of the α2δ voltage-gated Ca2+ channel auxiliary subunit family. CACHD1 mRNA and protein were highly expressed in the male mammalian CNS

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service