The gene CAHD1 (Cache domain-containing protein 1) is mapped to human chromosome 1p31.3.
Immunogen
Synthetic peptide directed towards the N terminal region of human CACHD1
Application
Anti-CACHD1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
CACHD1 (Cache domain-containing protein 1) is a calcium channel protein that is important for excitation-contraction coupling. It is differentially regulated in humans suffering from parkinson disease. CACHD1 is up-regulated in human embryonic stem cells and is down-modulated upon differentiation.
Sequence
Synthetic peptide located within the following region: HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The identification of molecular pathways of differentiation of embryonic stem cells (hESC) is critical for the development of stem cell based medical therapies. In order to identify biomarkers and potential regulators of the process of differentiation, a high quality microarray
Biomarkers in Parkinson Disease: global gene expression analysis in peripheral blood from patients with and without mutations inPARK2 and PARK8.
Annals of the New York Academy of Sciences, 1150, 282-289 (2009-01-06)
The MHC region (6p21) aggregates the major genes that contribute to susceptibility to type 1 diabetes (T1D). Three additional relevant susceptibility regions mapped on chromosomes 1p13 (PTPN22), 2q33 (CTLA-4), and 11p15 (insulin) have also been described by linkage studies. To
The Journal of neuroscience : the official journal of the Society for Neuroscience, 38(43), 9186-9201 (2018-09-06)
The putative cache (Ca2+ channel and chemotaxis receptor) domain containing 1 (CACHD1) protein has predicted structural similarities to members of the α2δ voltage-gated Ca2+ channel auxiliary subunit family. CACHD1 mRNA and protein were highly expressed in the male mammalian CNS
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
