The previously assigned protein identifier A8K535 has been merged into Q8IUX1. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the middle region of human TMEM126B
Application
Anti-TMEM126B antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions
Transmembrane protein 126B (TMEM126B; HT007) is a component of mitochondrial complex I and is essential for the assembly and constructing the membrane arm of the complex. Mitochondrial complex I mediates electron entry from NADH into the electron transport chain.
Sequence
Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Proceedings of the National Academy of Sciences of the United States of America, 110(47), 18934-18939 (2013-11-06)
Mitochondrial respiratory complex I is a product of both the nuclear and mitochondrial genomes. The integration of seven subunits encoded in mitochondrial DNA into the inner membrane, their association with 14 nuclear-encoded membrane subunits, the construction of the extrinsic arm
Macromolecular complexes are essential players in numerous biological processes. They are often large, dynamic, and rather labile; approaches to study them are scarce. Covering masses up to ∼30 MDa, we separated the native complexome of rat heart mitochondria by blue-native and
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.