AV48733

Anti-NAT6 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-FUS-2, Anti-FUS2, Anti-N-Acetyltransferase 6
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 34 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_036323
• UniProt accession no.: Q93015
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NAT6(24142)

Description

General description

NAT6 codes for N-acetyltransferase 6 (GCN5-related), a cytoplasmic enzyme that is specific for N-terminal methionine-containing proteins.
Rabbit Anti-NAT6 antibody recognizes human NAT6.

Immunogen

Synthetic peptide directed towards the C terminal region of human NAT6

Application

Rabbit Anti-NAT6 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

NAT6 belongs to the acetyltransferase family. It contains 1 N-acetyltransferase domain. NAT6 seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. It may act as a tumor suppressor. Defects in NAT6 are found in non-small cell lung cancer (NSCLC) cell lines.

Sequence

Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable