Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV48471

Sigma-Aldrich

Anti-HPRT1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-HGPRT, Anti-HPRT, Anti-Hypoxanthine phosphoribosyltransferase 1 (Lesch-Nyhan syndrome)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

24 kDa

species reactivity

human, horse, rabbit, mouse, rat, dog, bovine, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HPRT1(3251)

General description

Hypoxanthine phosphoribosyltransferase 1 (HPRT1) is known to catalyze the transfer of 5-phosphoribosyl group, thereby converting hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate during purine nucleotide synthesis. HPRT1-ALDH16A1 interactions have been linked to the pathophysiology of gout. HPRT1 mutation has been associated with Lesch-Nyhan disease.
Rabbit Anti-HPRT1 antibody recognizes zebrafish, bovine, canine, human, mouse, rat, pig, chicken, and rabbit HPRT1.

Immunogen

Synthetic peptide directed towards the middle region of human HPRT1

Application

Rabbit Anti-HPRT1 antibody has been used for western blot applications.

Biochem/physiol Actions

HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate (Keebaugh et al., 2007 [PubMed 16928426]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A novel mutation in HPRT1 gene causing variant form of Lesch-Nyhan disease.
Felippe Borlot et al.
Pediatric neurology, 49(2), e5-e7 (2013-07-19)
Abu Hena Mostafa Kamal et al.
Journal of proteomics, 94, 327-336 (2013-10-17)
Brown adipocytes oxidize fatty acids to produce heat in response to cold or caloric overfeeding. The motivation and function of the development of brown fat may thus counteract obesity, though this remains uncertain. We investigated the brown adipocyte proteome by
Vasilis Vasiliou et al.
Chemico-biological interactions, 202(1-3), 22-31 (2013-01-26)
Gout, a common form of inflammatory arthritis, is strongly associated with elevated uric acid concentrations in the blood (hyperuricemia). A recent study in Icelanders identified a rare missense single nucleotide polymorphism (SNP) in the ALDH16A1 gene, ALDH16A1*2, to be associated

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service