Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV48390

Sigma-Aldrich

Anti-LZTFL1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-FLJ36386, Anti-Leucine zipper transcription factor-like 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

pig, human, rat, bovine, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

Storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LZTFL1(54585)

General description

Leucine zipper transcription factor-like 1 (LZTFL1) is a cytoplasmic protein that interacts with Bardet-Biedl Syndrome (BBS) proteins and regulates their ciliary trafficking. Mutations in this leucine zipper gene have been linked to mesoxial polydactyly in BBS patients. It is also involved in the attenuation of cognitive impairment.
Rabbit Anti-LZTFL1 antibody recognizes human, mouse, rat, canine, zebrafish, and bovine LZTFL1.

Immunogen

Synthetic peptide directed towards the C terminal region of human LZTFL1

Application

Rabbit Anti-LZTFL1 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Sequence

Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

E Schaefer et al.
Clinical genetics, 85(5), 476-481 (2013-05-23)
Ciliopathies are heterogeneous disorders sharing different clinical signs due to a defect at the level of the primary cilia/centrosome complex. Postaxial polydactyly is frequently reported in ciliopathies, especially in Bardet-Biedl syndrome (BBS). Clinical features and genetic results observed in a
Takuya Sakurai et al.
Biochemical and biophysical research communications, 416(1-2), 125-129 (2011-11-19)
It is well known that exercise prevents and reduces cognitive impairment. In the present study, we focused on exercise training as a tool to prevent cognitive impairment, and searched for novel molecules that may relate to the prevention of cognitive
Seongjin Seo et al.
PLoS genetics, 7(11), e1002358-e1002358 (2011-11-11)
Many signaling proteins including G protein-coupled receptors localize to primary cilia, regulating cellular processes including differentiation, proliferation, organogenesis, and tumorigenesis. Bardet-Biedl Syndrome (BBS) proteins are involved in maintaining ciliary function by mediating protein trafficking to the cilia. However, the mechanisms

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service