AV48196
Anti-CRYAB antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-CRYA2, Anti-CTPP2, Anti-Crystallin, α B, Anti-HSPB5
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.43
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
20 kDa
species reactivity
rat, mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CRYAB(1410)
General description
Crystallin, α B (CRYAB) is a molecular chaperone that holds protein in soluble aggregates. It functions as a tumor suppressor by interacting with adherens junction to inhibit the progression of nasopharyngeal carcinoma. It is also known to inhibit stimulation of CD4+ T cells in relapsing-remitting multiple sclerosis patients.
Rabbit Anti-CRYAB antibody recognizes canine, rabbit, pig, human, mouse, rat, and bovine CRYAB.
Rabbit Anti-CRYAB antibody recognizes canine, rabbit, pig, human, mouse, rat, and bovine CRYAB.
Immunogen
Synthetic peptide directed towards the C terminal region of human CRYAB
Application
Rabbit Anti-CRYAB antibody is suitable for western blot applications at a concentration of 5 μg/ml.
Biochem/physiol Actions
Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.
Sequence
Synthetic peptide located within the following region: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
CRYAB modulates the activation of CD4+ T cells from relapsing-remitting multiple sclerosis patients.
Que Lan Quach et al.
Multiple sclerosis (Houndmills, Basingstoke, England), 19(14), 1867-1877 (2013-06-06)
Suppression of activation of pathogenic CD4(+) T cells is a potential therapeutic intervention in multiple sclerosis (MS). We previously showed that a small heat shock protein, CRYAB, reduced T cell proliferation, pro-inflammatory cytokine production and clinical signs of experimental allergic
Z Huang et al.
Oncogene, 31(32), 3709-3720 (2011-12-14)
Alpha B-crystallin (CRYAB) maps within the nasopharyngeal carcinoma (NPC) tumor-suppressive critical region 11q22-23 and its downregulation is significantly associated with the progression of NPC. However, little is known about the functional impact of CRYAB on NPC progression. In this study
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service