Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV48185

Sigma-Aldrich

Anti-ATP5B (AB1) antibody produced in rabbit

IgG fraction of antiserum, lyophilized powder

Synonym(s):

Anti-ATP synthase, H+ transporting, mitochondrial F1 complex, β polypeptide, Anti-ATPMB, Anti-ATPSB, Anti-MGC5231

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

52 kDa

species reactivity

canine, rat, human, rabbit, horse, pig, bovine, mouse

technique(s)

immunohistochemistry: suitable
western blot: suitable

immunogen sequence

IMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLL

NCBI accession no.

Storage temp.

−20°C

Gene Information

human ... ATP5B(506)

Immunogen

synthetic peptide corresponding to a region of human ATP5B with an internal ID of P28694

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

13 - Non Combustible Solids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Silvia Ravera et al.
Journal of neuroscience research, 99(9), 2250-2260 (2021-06-05)
The nervous system displays high energy consumption, apparently not fulfilled by mitochondria, which are underrepresented therein. The oxidative phosphorylation (OxPhos) activity, a mitochondrial process that aerobically provides ATP, has also been reported also in the myelin sheath and the rod
Christian U Huebbers et al.
Oncotarget, 6(34), 36172-36184 (2015-10-10)
A hallmark of solid tumors is the consumption of large amounts of glucose and production of lactate, also known as Warburg-like metabolism. This metabolic phenotype is typical for aggressive tumor growth, and can be visualized by 18F-fluorodeoxyglucose (18F-FDG) uptake detected
Randall M Chin et al.
Nature, 510(7505), 397-401 (2014-05-16)
Metabolism and ageing are intimately linked. Compared with ad libitum feeding, dietary restriction consistently extends lifespan and delays age-related diseases in evolutionarily diverse organisms. Similar conditions of nutrient limitation and genetic or pharmacological perturbations of nutrient or energy metabolism also

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service