Chondroitin sulfate N-acetylgalactosaminyltransferase 1 (CSGALNACT1) is a Golgi membrane protein that regulates the imitation of chondroitin sulphate (CS) biosynthesis. Studies in mouse have revealed that CSGALNACT1 is responsible for the synthesis of around half of the total CS chains present in epiphyseal cartilages. Rabbit Anti-CSGALNACT1 antibody recognizes chicken, canine, zebrafish, bovine, human, mouse, and rat CSGALNACT1.
Immunogen
Synthetic peptide directed towards the N terminal region of human CSGALNACT1
Application
Rabbit Anti-CSGALNACT1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.
Biochem/physiol Actions
CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.
Sequence
Synthetic peptide located within the following region: KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Glycosaminoglycan (GAG) assembly initiates through the formation of a linkage tetrasaccharide region serving as a primer for both chondroitin sulfate (CS) and heparan sulfate (HS) chain polymerization. A possible role for sulfation of the linkage structure and of the constitutive
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
