Synthetic peptide directed towards the C terminal region of human TMED3
Application
Anti-TMED3 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL.
Biochem/physiol Actions
TMED3 (transmembrane emp24 protein transport domain containing 3) gene encodes for single-pass type I membrane protein that belongs to EMP24/GP25L family. It plays a crucial role in vesicular protein trafficking, mainly in the early secretory pathway as well as assists in coupled localization of TMED2 and TMED10 in the cis-Golgi network. P24 protein bind to coat proteins of COPI and COPII vesicles and may facilitate the vesicle biogenesis, cargo uptake and quality control.
Sequence
Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of cell science, 113 ( Pt 13), 2507-2516 (2000-06-15)
Recent studies show that small trans-membrane proteins of approximately 22-24 kDa (the p24 family), which are grouped into 4 sub-families by sequence homology (p23, p24, p25 and p26), are involved in the early secretory pathway. In this study, we have
The Journal of biological chemistry, 277(48), 46504-46511 (2002-09-19)
The p24 proteins belong to a highly conserved family of membrane proteins that cycle in the early secretory pathway. They bind to the coat proteins of COPI and COPII vesicles, and are proposed to be involved in vesicle biogenesis, cargo
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
