Synthetic peptide directed towards the C terminal region of human ST3GAL2
Application
Anti-ST3GAL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) gene encodes a type II membrane protein that belongs to the glycosyltransferase family 29. It plays a pivotal role in transfering the sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL2 is a MSGb5 (stage-specific embryonic antigen-4) synthase and increased expression of ST3Gal II facilitates as a marker for renal carcinogenesis.
Sequence
Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of biological chemistry, 278(29), 26474-26479 (2003-04-30)
Monosialosyl globopentaosylceramide (MSGb5), originally described as stage-specific embryonic antigen-4, is expressed in testicular germ cell tumors and in aggressive cases of human renal cell carcinoma (RCC). Clarification of the molecular mechanisms regulating synthesis of MSGb5 is very important to understand
Biochemical and biophysical research communications, 300(2), 570-576 (2002-12-31)
In this report, we describe transcriptional regulation of the human Gal beta 1,3 GalNAc alpha 2,3-sialyltransferase II (hST3Gal II) gene. The results of 5'-RACE showed that the forms of two mRNAs differed only in the 5'-untranslated region (Types 1 and
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
