AV46706
Anti-ST3GAL3 (AB1) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-SIAT6, Anti-ST3 β-galactoside α-2,3-sialyltransferase 3, Anti-ST3GALII, Anti-ST3GalIII, Anti-ST3N
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$541.00
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(1)
Select a Size
Change View
100 μL
$541.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
42 kDa
species reactivity
mouse, guinea pig, rabbit, horse, rat, bovine, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ST3GAL3(6487)
General description
ST3 β-galactoside α-2,3-sialyltransferase 3 (ST3GAL3,ST3GalIII, SIAT6) is a sialic acid transferring type II membrane protein found primarily in the Gogi apparatus; wherein sialic acid is transferred from CMP-sialic acid to galactose residues. ST3GAL3 forms the sialyl Lewis epitope on proteins. Defects in ST3GAL3 are associated with cognitive dysfunction.
Specificity
Anti-ST3GAL3 (AB1) polyclonal antibody reacts with chicken, pig, bovine, canine, human, mouse, and rat β-galactoside α-2,3-sialyltransferase 3 proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human ST3GAL3
Application
Anti-ST3GAL3 (AB1) polyclonal antibody is used to tag β-galactoside α-2,3-sialyltransferase 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of β-galactoside α-2,3-sialyltransferase 3 in sialylation of glycoproteins in the Golgi apparatus.
Biochem/physiol Actions
ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.
Sequence
Synthetic peptide located within the following region: MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Rossella Indellicato et al.
Glycobiology, 30(2), 95-104 (2019-10-05)
Three missense variants of ST3GAL3 are known to be responsible for a congenital disorder of glycosylation determining a neurodevelopmental disorder (intellectual disability/epileptic encephalopathy). Here we report a novel nonsense variant, p.Y220*, in two dichorionic infant twins presenting a picture of
Hao Hu et al.
American journal of human genetics, 89(3), 407-414 (2011-09-13)
The genetic variants leading to impairment of intellectual performance are highly diverse and are still poorly understood. ST3GAL3 encodes the Golgi enzyme β-galactoside-α2,3-sialyltransferase-III that in humans predominantly forms the sialyl Lewis a epitope on proteins. ST3GAL3 resides on chromosome 1
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
