Brambell receptor (FcRB, FcRn) is a neonatal Fc receptor that mediates transmission of immunity from mother to young perinatally across epithelial cells and plays a central role in IgG protection and homeostasis throughout life. Fc fragment of IgG, receptor, transporter, α (FCGRT) is the heavy (α) chain of FcRn an Fc receptor that structurally resembles the major histocompatibility complex class I molecule.
Specificity
Anti-FCGRT polyclonal antibody reacts with pig, human, mouse, bovine, and canine the α subunit of the neonatal receptor FcRn.
Immunogen
The immunogen for anti-FCGRT antibody: synthetic peptide derected towards the N terminal of human FCGRT
Application
Anti-FCGRT polyclonal antibody is used to tag Fc fragment of IgG, receptor, transporter, α protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of Fc fragment of IgG, receptor, transporter, α in the function of neonatal Fc receptor, FcRB.
Sequence
Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
