Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV46303

Sigma-Aldrich

Anti-PSAT1 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):

Anti-EPIP, Anti-MGC1460, Anti-PSA, Anti-PSAT, Anti-PhosphoSerine aminotransferase 1

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

40 kDa

species reactivity

horse, rabbit, zebrafish, human, mouse, bovine, rat, canine

technique(s)

immunohistochemistry: suitable
western blot: suitable

immunogen sequence

SAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETV

NCBI accession no.

NP_066977

UniProt accession no.

Q9Y617

storage temp.

−20°C

Gene Information

human ... PSAT1(29968)

Immunogen

synthetic peptide corresponding to a region of human PSAT1 with an internal ID of S17901

Application

Anti-PSAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.

Biochem/physiol Actions

PSAT1 (PhosphoSerine aminotransferase 1) gene also referred to as EPIP, MGC1460, PSA or PSAT encodes for an enzyme involved in the phosphorylated pathway of L-serine biosynthesis. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. Additionally, overexpression of PSAT1 induces cell growth and cancer progression as well as escalates chemoresistance of colon cancer cells.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

13 - Non Combustible Solids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC16302

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Joo Youn Baek et al.
The Biochemical journal, 373(Pt 1), 191-200 (2003-03-14)
In the present study, we first report two forms of human phosphoserine aminotransferase (PSAT) cDNA (HsPSAT alpha and HsPSAT beta). HsPSAT alpha has a predicted open reading frame comprising 324 amino acids, encoding a 35.2 kDa protein (PSAT alpha), whereas
Nadia Vié et al.
Molecular cancer, 7, 14-14 (2008-01-29)
Colorectal cancer (CRC) is one of the most common causes of cancer death throughout the world. In this work our aim was to study the role of the phosphoserine aminotransferase PSAT1 in colorectal cancer development. We first observed that PSAT1
M J Basurko et al.
IUBMB life, 48(5), 525-529 (2000-01-19)
As a step toward analyzing the serine biosynthetic pathway in mammals, we have studied the properties of phosphoserine aminotransferase, the second step-catalyzing enzyme. The K(m) values for 3-phosphohydroxypyruvate and L-phosphoserine are 5 and 35 microM, respectively, and those for glutamate

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service