Synthetic peptide directed towards the N-terminal region of Human PSME3
Application
Anti-PSME3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
Proteasomes are protein complexes that facilitate the degradation of damaged proteins by proteolysis. Proteasomes are located throughout the eukaryotic cells but primarily localized in nucleus. They are composed of 2 complexes, a 20S core and a 19S regulator. The modified proteasome referred to as immunoproteasome contains an alternate regulator that is 11S regulator or PA28 against 19S regulator. PSME3 gene encodes the gamma subunit of the 11S regulator. REG-gamma (also known as PA28-gamma) stimulates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. REG-gamma interact with both MDM2 and p53 proteins and stimulates ubiquitination- and MDM2-dependent proteasomal degradation of p53 which in turn restricts its accumulation and inhibits apoptosis after DNA damage.
Sequence
Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of biological chemistry, 269(10), 7709-7718 (1994-03-11)
The 26 S proteolytic complex ("26 S proteasome") is a macromolecular assembly thought to be involved in ATP- and ubiquitin-dependent protein degradation in the cytoplasm of higher eukaryotic cells. This complex is composed of one 20 S cylinder particle (multicatalytic
Archives of biochemistry and biophysics, 425(2), 158-164 (2004-04-28)
The proteasome activation properties of recombinant REG gamma molecules depend on purification procedures. Prior to ammonium sulfate precipitation recombinant REG gamma activates the trypsin-like catalytic subunit of the proteasome; afterwards it activates all three catalytic subunits. The expanded activation specificity
Downregulation of p53 by MDM2-mediated proteasomal degradation makes cells resistant to apoptosis. The MDM2-p53 interaction is well characterized, but the mechanisms that regulate the interaction are not well understood. Here, we show that PA28gamma, a proteasome activator that inhibits apoptosis
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
