Synthetic peptide directed towards the N terminal region of human SHMT2
Application
Anti-SHMT2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
SHMT2 gene encodes an enzyme serine hydroxymethyltransferase 2 (mitochondrial), which is a pyridoxal phosphate-dependent enzyme that regulates the biosynthesis of thymidylate in mammals. It catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. Additionally, it facilitates the interconversion of serine and glycine and is associated with mitochondrial DNA which assists in preventing the uracil accumulation in mtDNA.
Sequence
Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The three enzymes that constitute the de novo thymidylate synthesis pathway in mammals, cytoplasmic serine hydroxymethyltransferase (SHMT1), thymidylate synthase (TYMS) and dihydrofolate reductase (DHFR) undergo sumoylation and nuclear import during S-phase. In this study, we demonstrate that purified intact mouse
Proceedings of the National Academy of Sciences of the United States of America, 108(37), 15163-15168 (2011-08-31)
The de novo and salvage dTTP pathways are essential for maintaining cellular dTTP pools to ensure the faithful replication of both mitochondrial and nuclear DNA. Disregulation of dTTP pools results in mitochondrial dysfunction and nuclear genome instability due to an
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
