Synthetic peptide directed towards the C terminal region of human NOLC1
Application
Anti-NOLC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
NOLC1 encodes for a phosphoprotein, nucleolar and coiled-body phosphoprotein 1 that plays a crucial role in the synthesis of rRNA and the biosynthesis of ribosomes. It also induces tumorigenesis of nasopharyngeal carcinoma (NPC) and works cooperatively with tumor protein 53 for stimulating the MDM2 promoter in NPC cells.
Sequence
Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nucleolar and coiled-body phosphoprotein 1 (NOLC1) plays an essential role in the synthesis of rRNA and the biosynthesis of ribosomes. Previous studies suggest that NOLC1 is crucial for normal cell growth, and plays a role in the regulation of tumorigenesis of
The American journal of pathology, 175(1), 342-354 (2009-06-23)
Nasopharyngeal carcinoma (NPC) is one of the most common cancers among Chinese living in South China, Singapore, and Taiwan. At present, its etiological factors are not well defined. To identify which genetic alterations might be involved in NPC pathogenesis, we
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
