Synthetic peptide directed towards the C terminal region of human DFNA5
Application
Anti-DFNA5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
DFNA5 gene encodes a protein non-syndromic hearing impairment protein 5 also referred to as autosomal dominant 5 that expresses in foetal cochlea. It plays a pivotal role in apoptosis and cell survival. DFNA5 cooperates with TP53 and facilitates the p53-regulated cellular response to genotoxic stress.
Sequence
Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of human genetics, 51(8), 652-664 (2006-08-10)
The tumor suppressor p53 plays a crucial role in the cellular response to DNA damage by transcriptional activation of numerous downstream genes. Although a considerable number of p53 target genes have been reported, the precise mechanism of p53-regulated tumor suppression
European journal of human genetics : EJHG, 19(9), 965-973 (2011-04-28)
DFNA5 was first identified as a gene causing autosomal dominant hearing loss (HL). Different mutations have been found, all exerting a highly specific gain-of-function effect, in which skipping of exon 8 causes the HL. Later reports revealed the involvement of
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.