AV45699
Anti-ECHS1 (AB1) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Enoyl coenzyme A hydratase, short chain, 1, mitochondrial, Anti-SCEH
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$457.00
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(1)
Select a Size
Change View
100 μL
$457.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
28 kDa
species reactivity
horse, mouse, bovine, dog, human, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
Storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ECHS1(1892)
General description
ECHS1 (Enoyl CoA hydratase, short chain, 1, mitochondrial) is structurally located in chromosome 10q26.2-q26.3 region consisting of eight exons, with exons I and VIII with the 5′- and 3′-untranslated regions. It has a GC-rich 5′-flanking region with multiple copies of the SP1 binding motive. Its expressions have been found in the human liver, fibroblast and muscle.
Immunogen
Synthetic peptide directed towards the middle region of human ECHS1
Application
Anti-ECHS1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.
Biochem/physiol Actions
Enoyl CoA hydratase, short chain, 1 (ECHS1) is a mitochondrial enzyme that functions in the fatty acid β-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) to L-3-hydroxyacyl-CoAs. It also participates in different metabolic pathways involving fatty acids and amino acids. Study reports that heterozygous mutation in ECHS1 causes Leigh syndrome with hypotonia, metabolic acidosis, and developmental delay symptoms.
Sequence
Synthetic peptide located within the following region: RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
M Kanazawa et al.
Enzyme & protein, 47(1), 9-13 (1993-01-01)
Short chain enoyl-CoA hydratase (SCEH) catalyzes the second step of the mitochondrial fatty acid beta-oxidation spiral. We isolated cDNA clones for human SCEH to facilitate investigation of the enzyme structure of the gene and to examine the genetic background of
U Janssen et al.
Genomics, 40(3), 470-475 (1997-03-15)
The second step in mitochondrial fatty acid beta-oxidation is catalyzed by short chain enoyl-CoA hydratase (ECHS1; EC 4.2.1.17). Inherited disorders of this pathway of energy metabolism present clinical and laboratory features resembling sudden infant death syndrome and Reye-like syndrome. To
Enzymes of fatty acid metabolism. II. Properties of crystalline crotonase.
J R STERN et al.
The Journal of biological chemistry, 218(2), 985-1002 (1956-02-01)
Chika Sakai et al.
Human mutation, 36(2), 232-239 (2014-11-14)
The human ECHS1 gene encodes the short-chain enoyl coenzyme A hydratase, the enzyme that catalyzes the second step of β-oxidation of fatty acids in the mitochondrial matrix. We report on a boy with ECHS1 deficiency who was diagnosed with Leigh
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
