Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV45356

Sigma-Aldrich

Anti-PTN antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):

Anti-HARP, Anti-HBGF8, Anti-HBNF, Anti-NEGF1, Anti-Pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1)

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

19 kDa

species reactivity

human, canine, rat, bovine, chicken, horse, pig, rabbit, mouse

technique(s)

western blot: suitable

immunogen sequence

TGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

NCBI accession no.

NP_002816

UniProt accession no.

P21246

Storage temp.

−20°C

Gene Information

human ... PTN(5764)

Immunogen

synthetic peptide corresponding to a region of human PTN with an internal ID of P26906

Application

Anti-PTN antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

Pleiotrophin (PTN) belongs to the family of heparin-binding growth factors that is widely expressed in many tissues during development but is restricted to bone and the nervous system post-natally. It is induces the migration of osteoblasts and mediates the differentiation of bone marrow-derived stromal cells. It induces the neurite extension during the development of brain. PTN is, therefore, important for the development of brain and the development and/or regeneration of bone and cartilage.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

13 - Non Combustible Solids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC17981

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

H Rauvala
The EMBO journal, 8(10), 2933-2941 (1989-10-01)
An 18-kd heparin-binding protein (p18) was isolated from perinatal rat brain. Although the protein closely resembles the fibroblast growth factors in its strong binding to heparin and in its apparent molecular mass, it has a distinct structure. This was concluded
S Imai et al.
The Journal of cell biology, 143(4), 1113-1128 (1998-11-17)
Bone has an enormous capacity for growth, regeneration, and remodeling. This capacity is largely due to induction of osteoblasts that are recruited to the site of bone formation. The recruitment of osteoblasts has not been fully elucidated, though the immediate
T A Mitsiadis et al.
Development (Cambridge, England), 121(1), 37-51 (1995-01-01)
Midkine (MK) and heparin binding-growth associated molecule (HB-GAM or pleiotrophin), constitute a new family of heparin-binding proteins implicated in the regulation of growth and differentiation (T. Muramatsu (1993) Int. J. Dev. Biol. 37, 183-188). We used affinity-purified antibodies against MK
Thibault Bouderlique et al.
PloS one, 9(2), e88287-e88287 (2014-02-12)
Pleiotrophin (PTN) is a growth factor present in the extracellular matrix of the growth plate during bone development and in the callus during bone healing. Bone healing is a complicated process that recapitulates endochondral bone development and involves many cell

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service