The immunogen for anti-UGT1A1 antibody: synthetic peptide derected towards the middle region of human UGT1A1
Application
Anti-PSEN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1; GNT1) is an enzyme that catalyzes the transformation of small lipophilic molecules to water-soluble excretable metabolites via the glucuronidation pathway. Deficiency in UGT1A1 results in Crigler-Najjar syndrome and neonatal hyperbilirubinemia.
Sequence
Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Crigler-Najjar syndrome (CNS), caused by deficiency of bilirubin uridine diphosphate glucuronosyltransferase (UGT) 1A1, is a rare and autosomal recessive inherited disorder characterized by severe unconjugated nonhemolytic hyperbilirubinemia since birth. We present a girl with CNS type I caused by a
Journal of the Medical Association of Thailand = Chotmaihet thangphaet, 95 Suppl 1, S13-S17 (2012-01-01)
Neonatal hyperbilirubinemia is a common problem in neonates and affects 60% of Asian newborn babies which is twice that found in Caucasians. These findings suggest that a genetic factor might be involved. Recently, a relationship between polymorphisms of the bilirubin
Drug metabolism and pharmacokinetics, 28(2), 83-92 (2012-10-24)
Human UDP-glucuronosyltransferase (UGT) 1A1 is the enzyme that detoxifies neurotoxic bilirubin by conjugating it with glucuronic acid. UGT1A1 also plays a critical role in the detoxification and excretion of endogenous and exogenous lipophilic compounds mainly in the liver and gastrointestinal
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.