Solute carrier family 7 (cationic amino acid transporter, y+ system), member 14 (SLC7A14) is a y+ system cationic amino acid transporter family member with an unknown function.
Specificity
Anti-SLC7A14 polyclonal antibody reacts with zebrafish, human, mouse, rat, chicken, canine, and bovine solute carrier family 7 (cationic amino acid transporter, y+ system), member 14 proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human SLC7A14
Application
Anti-SLC7A14 polyclonal antibody is used to tag solute carrier family 7 (cationic amino acid transporter, y+ system), member 14 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the currently unknown roles of solute carrier family 7 (cationic amino acid transporter, y+ system), member 14.
Sequence
Synthetic peptide located within the following region: VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
