Ligand of numb-protein X 1 (LNX1) is an E3 ubiquitin ligase which contains RING (Really Interesting New Gene) and PDZ (Post-synaptic density, 95 kDa, Discs large, Zona Occludens-1) domains. LNX1 may function as a signaling scaffold protein with a PDZ domain has been shown to bind KCNA4, PAK6, PLEKHG5, PKC-α1, TγK2 and PBK.
Specificity
Anti-LNX1 polyclonal antibody reacts with bovine, canine, human, mouse, and rat ligand of numb-protein X 1 proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human LNX1
Application
Anti-LNX1 polyclonal antibody is used to tag ligand of numb-protein X 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of ligand of numb-protein X 1 as a signaling scaffold and E3 ubiquitin ligase.
Biochem/physiol Actions
LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene.
Sequence
Synthetic peptide located within the following region: SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
