AV41730

Anti-KRT10 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-CK10, Anti-K10, Anti-KPP, Anti-Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris)
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• mol wt: 59 kDa
• species reactivity: mouse, rat, human, dog, rabbit, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_000412
• UniProt accession no.: P13645
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KRT10(3858)

Description

General description

Keratins are stage specific components of intermediate filaments found in differentiating keratinocytes. Mutations of different keratins are associated with a variety of skin diseases. Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) (KRT10) has been associated with non-palms and soles (NPS) subgroup of epidermolytic hyperkeratosis (EHK) and bullous congenital ichthyosiform erythroderma (BCIE).

Specificity

Anti-KRT10 polyclonal antibody reacts with bovine, human, mouse, rat, canine, and rabbit keratin 10 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human KRT10

Application

Anti-KRT10 polyclonal antibody is used to tag keratin 10 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the presence of keratin-10 at different stages of keratin differentiation.

Biochem/physiol Actions

KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis. This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable