Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV41730

Sigma-Aldrich

Anti-KRT10 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CK10, Anti-K10, Anti-KPP, Anti-Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

mol wt

59 kDa

species reactivity

mouse, rat, human, dog, rabbit, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KRT10(3858)

General description

Keratins are stage specific components of intermediate filaments found in differentiating keratinocytes. Mutations of different keratins are associated with a variety of skin diseases. Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) (KRT10) has been associated with non-palms and soles (NPS) subgroup of epidermolytic hyperkeratosis (EHK) and bullous congenital ichthyosiform erythroderma (BCIE).

Specificity

Anti-KRT10 polyclonal antibody reacts with bovine, human, mouse, rat, canine, and rabbit keratin 10 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human KRT10

Application

Anti-KRT10 polyclonal antibody is used to tag keratin 10 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the presence of keratin-10 at different stages of keratin differentiation.

Biochem/physiol Actions

KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis. This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jessica Martínez-Vargas et al.
PloS one, 12(9), e0183556-e0183556 (2017-09-28)
Bicuspid aortic valve (BAV) is the most prevalent human congenital cardiac malformation. It may appear isolated, associated with other cardiovascular malformations, or forming part of syndromes. Cranial neural crest (NC) defects are supposed to be the cause of the spectrum

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service