Eukaryotic translation initiation factor 4E family member 3 (EIF4E3) is a member of the eukaryotic translation initiation factor 4E (eIF4E) family involved in the initiation of mRNA translation by binding to its 5′-prime cap structure and targeting the mRNA to the ribosome.
Specificity
Anti-EIF4E3 polyclonal antibody reacts with chicken, human, mouse, rat, bovine, and zebrafish eukaryotic translation initiation factor 4E family member 3 proteins.
Immunogen
Synthetic peptide directed towards the middle region of human EIF4E3
Application
Anti-EIF4E3 polyclonal antibody is used to tag eukaryotic translation initiation factor 4E family member 3 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of eukaryotic translation initiation factor 4E family member 3 in the initiation of mRNA translation.
Biochem/physiol Actions
EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.
Sequence
Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
