RNA binding motif protein 45 (RBM45, DRB1) is a member of the neural RNA recognition motif (RRM)-type neural RNA-binding protein involved in essential roles in neural development. DRB1 possesses a binding preference for poly(C)RNA.
Specificity
Anti-RBM45 polyclonal antibody reacts with rat, bovine, human, mouse, rat, and human RNA binding motif protein 45 proteins.
Immunogen
The immunogen for anti-RBM45 antibody: synthetic peptide derected towards the middle region of human RBM45
Application
Anti-RBM45 polyclonal antibody is used to tag RNA binding motif protein 45 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein 45 in poly(C)RNA binding and neural development.
Synthetic peptide located within the following region: MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
RNA-binding protein pathology now represents one of the best characterized pathologic features of amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration patients with TDP-43 or FUS pathology (FTLD-TDP and FTLD-FUS). Using liquid chromatography tandem mass spectrometry, we identified altered levels
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
