Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV39076

Sigma-Aldrich

Anti-BRD4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Bromodomain containing 4, Anti-CAP, Anti-HUNKI, Anti-MCAP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

80 kDa

species reactivity

rat, rabbit, mouse, canine, human, guinea pig, horse, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... BRD4(23476)

General description

Bromodomain containing 4 (Brd4), a member of the BET family of proteins, has been shown to play important roles in cellular growth control, cell cycle progression, and cancer development. Brd4 is a chromatin adapter molecule crucial for transmitting epigenetic information by acting as a histone acetylation-dependent gene bookmark and accelerating post-mitotic transcriptional reactivation. Bdr4 localizes to chromosomes during mitosis and during interphase it interacts with P-TEFb to function as a global transcriptional coactivator. BRD4, has been identified recently as a therapeutic target in acute myeloid leukemia, multiple myeloma, Burkitt′s lymphoma, NUT midline carcinoma, colon cancer, and inflammatory disease; its loss is a prognostic signature for metastatic breast cancer. BRD4 also contributes to regulation of both cell cycle and transcription of oncogenes, HIV, and human papilloma virus (HPV).

Specificity

Anti-Bromodomain containing 4 polyclonal antibody reacts with human, mouse, rat, bovine, and canine Brd4 proteins.

Immunogen

The immunogen for anti-BRD4 antibody: synthetic peptide derected towards the C terminal of human BRD4

Application

Anti-Bromodomain containing 4 polyclonal antibody is used to tag Brd4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of Brd4 in cellular growth control, cell cycle progression, and cancer development.

Sequence

Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

11 - Combustible Solids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Scott R Floyd et al.
Nature, 498(7453), 246-250 (2013-06-04)
DNA damage activates a signalling network that blocks cell-cycle progression, recruits DNA repair factors and/or triggers senescence or programmed cell death. Alterations in chromatin structure are implicated in the initiation and propagation of the DNA damage response. Here we further
Mi-Sun Kang et al.
Cell reports, 29(13), 4632-4645 (2019-12-26)
Proliferating cell nuclear antigen (PCNA) is a DNA clamp essential for DNA replication. During DNA synthesis, PCNA is continuously loaded onto and unloaded from DNA. PCNA recruits various proteins to nascent DNA to facilitate chromosome duplication. Therefore, timely PCNA unloading

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service