AV38212
Anti-SIAH1 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Seven in absentia homolog 1 (Drosophila)
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$457.00
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(3)
Select a Size
Change View
100 μL
$457.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
31 kDa
species reactivity
guinea pig, mouse, rat, bovine, rabbit, human, horse, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SIAH1(6477)
General description
Seven in absentia homolog 1 (Drosophila) (SIAH1) is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. SIAH1 has an overlapping function with SIAH2. SIAH1 is involved in the regulation of cellular response to hypoxia and induction of apoptosis. SIAH1 triggers the ubiquitin-mediated degradation of many substrates including the cell surface receptors (DCC, FLT3), the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), and transcription regulators (MγB, POU2AF1, PML and RBBP8). SIAH1 confers constitutive instability to HIPK2 through proteasomal degradation.
Specificity
Anti-SIAH1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, chicken, and canine seven in absentia homolog 1 (Drosophila) proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human SIAH1
Application
Anti-SIAH1 (AB2) polyclonal antibody is used to tag seven in absentia homolog 1 (Drosophila) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of seven in absentia homolog 1 (Drosophila) in many proteosome regulated cellular processes such as response to hypoxia and apoptosis.
Biochem/physiol Actions
SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Sequence
Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Yan Wang et al.
Neuro-oncology, 24(12), 2107-2120 (2022-06-21)
We previously report that yes-associated protein (YAP), the core downstream effector of Hippo pathway, promotes the malignant progression of glioblastoma (GBM). However, although classical regulatory mechanisms of YAP are well explored, how YAP is modulated by the Hippo-independent manner remains
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
